Preply — Study more efficiently by working with a personal tutor. Get 50% off.Affiliate

Wikipedia

Ascidian mitochondrial code

The ascidian mitochondrial code (translation table 13) is a genetic code found in the mitochondria of Ascidiacea.

Code AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSGGVVVVAAAADDEEGGGG Starts = ---M------------------------------MM---------------M------------ Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

Systematic range and comments There is evidence from a phylogenetically diverse sample of tunicates (Urochordata) that AGA and AGG code for glycine. In other organisms, AGA/AGG code for either arginine or serine and in vertebrate mitochondria they code a STOP. Evidence for glycine translation of AGA/AGG was first found in 1993 in Pyura stolonifera and Halocynthia roretzi. It was then confirmed by tRNA sequencing and sequencing whole mitochondrial genomes.

Alternative initiation codons ATA, GTG and TTG ATT is the start codon for the CytB gene in Halocynthia roretzi.

See also List of genetic codes

References This article incorporates text from the United States National Library of Medicine, which is in the public domain.

Tags

  • Gene expression
  • Genetics stubs
  • Molecular genetics
  • Protein biosynthesis