science

GTx1-15

GTx1-15 is a science topic covered in the lgStudy science library. This page brings together a partial reference excerpt, illustrations, worked examples, real-world applications and a short study plan, so you can understand GTx1-15 rather than just read about it. In short: GTx1-15 is a toxin from the Chilean tarantula venom that acts as both a voltage-gated calcium channel blocker and a voltage-gated sodium channel blocker. Sources GTx1-15 is derived from the Chilean tarantula species Grammostola rosea and Phrixotrichus scrofa.

Key takeaways

GTx1-15 belongs to science; place it in that map before memorising details.
Learn the definition first, then one example that makes the definition concrete.
Connect GTx1-15 to a quantity you can measure, compute or draw — that is where exam questions come from.
Reproduce the core statement of GTx1-15 from memory before moving on to harder problems.

Reference excerpt

GTx1-15 is a toxin from the Chilean tarantula venom that acts as both a voltage-gated calcium channel blocker and a voltage-gated sodium channel blocker.

Sources GTx1-15 is derived from the Chilean tarantula species Grammostola rosea and Phrixotrichus scrofa.

Chemistry

Sequence GTx1-15 is composed of 34 amino acid residues; its sequence has been determined to be DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCQYVF. This peptide has a molecular weight of approximately 4 kDa and is amidated at its carboxy terminus.

Structure and Family GTx1-15 belongs to the GTx1 family, which consists of long loop inhibitor cystine knot (ICK) motif toxins. The GTx1-15 peptide has a conserved structure of six cysteine residues with the characteristic ICK motif, which results in proteolytic, thermal, and chemical stability.

Homology GTx1-15 displays sequence homology with other ion channel toxins from several spider species. It is homologous in sequence with sodium channel blocker PaurTx3 by 76.5%, and it also shares similarities in sequence with HnTx-IV (60%), CcoTx2 (55.9%), TLTx1 (55.6%), ω-GrTx SIA (40%), GsAFII (38.2%) and GsMTx2 (38.2%).

Target and Mode of Action GTx1-15 targets low-voltage activated cation channels. It specifically inhibits:

T-type calcium channel Cav3.1 Sodium channels Nav1. GTx1-15 has a strong inhibitory effect on tetrodotoxin-sensitive (TTX-S) sodium channels (Nav1.7 and Nav1.3), but has a minimal effect on tetrodotoxin-resistant sodium channels (Nav1.5 and Nav1.8). The mode of action of GTx1-15 has not yet been clarified.

IC50 The effectiveness of GTx1-15 as a blocker of human cloned Nav and Cav channels is summarized below:

References

Worked examples

Example 1 — a first encounter with GTx1-15

Start with the simplest possible case. Write down what GTx1-15 claims or describes in one sentence, then invent the smallest concrete situation in which that sentence is true. In science, the smallest case is usually a single object, a single equation or a single measurement. Check that every symbol or term in your sentence has a meaning in that case.

Example 2 — changing one variable

Take the situation from Example 1 and change exactly one quantity: double it, halve it, or set it to zero. Predict what should happen to GTx1-15 before you calculate. Comparing your prediction with the result is the fastest way to find out whether you understand the idea or only the words.

Example 3 — an exam-style question

Typical questions about GTx1-15 ask you to (a) state it precisely, (b) apply it to given data, and (c) explain a limitation. Practise writing all three answers in under five minutes; the third part is what separates a full-mark answer from an average one.

Applications of GTx1-15

In research: GTx1-15 appears in science research whenever the underlying quantities have to be modelled precisely. Papers usually cite it as a starting assumption and then explore where it breaks down.
In technology and industry: Engineering practice reuses GTx1-15 in design rules, simulations and safety margins. Knowing the idea lets you read a specification sheet and understand why the numbers look the way they do.
In the classroom: GTx1-15 is common in secondary-school and first-year university syllabi. It links to neighbouring topics Ion channel toxins, Spider toxins, so understanding it makes those chapters shorter.
In everyday life: Look for GTx1-15 outside the textbook — in sport, cooking, traffic, electronics or the sky above you. An example you found yourself is remembered far longer than one you were given.

Ask Teacher Smith questions about this articleOpens your AI tutor with a question about “GTx1-15” →

Affiliate

Preply — study more efficiently by working with a personal tutor. 50% off.

How to study GTx1-15 in 20 minutes

Read the reference excerpt below once, without taking notes.
Close the page and write down what GTx1-15 means in your own words.
Compare your version with the excerpt and mark what you missed.
Work through the three examples above with pen and paper.
Explain GTx1-15 out loud to somebody else — or to Teacher Smith in the lgStudy chat.

Frequently asked questions

What is GTx1-15 in simple terms?

GTx1-15 is a toxin from the Chilean tarantula venom that acts as both a voltage-gated calcium channel blocker and a voltage-gated sodium channel blocker. Sources GTx1-15 is derived from the Chilean tarantula species Grammostola rosea and Phrixotrichus scrofa.

Why does GTx1-15 matter?

Because it connects several science ideas at once: it gives you a definition you can apply, a quantity you can calculate, and a way to check whether a result is plausible.

How should I study GTx1-15?

Read the excerpt, restate it from memory, then work through the examples and applications listed on this page. The five-step study plan above takes about twenty minutes.

What does this page cover?

It gives you a compact reference excerpt plus original lgStudy explanations, examples, applications and study material on GTx1-15.