chemistry

Glucagon-like peptide-2

Glucagon-like peptide-2 is a chemistry topic covered in the lgStudy science library. This page brings together a partial reference excerpt, illustrations, worked examples, real-world applications and a short study plan, so you can understand Glucagon-like peptide-2 rather than just read about it. In short: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).

Key takeaways

Glucagon-like peptide-2 belongs to chemistry; place it in that map before memorising details.
Learn the definition first, then one example that makes the definition concrete.
Connect Glucagon-like peptide-2 to a quantity you can measure, compute or draw — that is where exam questions come from.
Reproduce the core statement of Glucagon-like peptide-2 from memory before moving on to harder problems.

Reference excerpt

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.

See also Glucagon-like peptide 2 receptor

References

External links Banting and Best Diabetes Centre at UT glp2

Worked examples

Example 1 — a first encounter with Glucagon-like peptide-2

Start with the simplest possible case. Write down what Glucagon-like peptide-2 claims or describes in one sentence, then invent the smallest concrete situation in which that sentence is true. In chemistry, the smallest case is usually a single object, a single equation or a single measurement. Check that every symbol or term in your sentence has a meaning in that case.

Example 2 — changing one variable

Take the situation from Example 1 and change exactly one quantity: double it, halve it, or set it to zero. Predict what should happen to Glucagon-like peptide-2 before you calculate. Comparing your prediction with the result is the fastest way to find out whether you understand the idea or only the words.

Example 3 — an exam-style question

Typical questions about Glucagon-like peptide-2 ask you to (a) state it precisely, (b) apply it to given data, and (c) explain a limitation. Practise writing all three answers in under five minutes; the third part is what separates a full-mark answer from an average one.

Applications of Glucagon-like peptide-2

In research: Glucagon-like peptide-2 appears in chemistry research whenever the underlying quantities have to be modelled precisely. Papers usually cite it as a starting assumption and then explore where it breaks down.
In technology and industry: Engineering practice reuses Glucagon-like peptide-2 in design rules, simulations and safety margins. Knowing the idea lets you read a specification sheet and understand why the numbers look the way they do.
In the classroom: Glucagon-like peptide-2 is common in secondary-school and first-year university syllabi. It links to neighbouring topics Biomolecules, so understanding it makes those chapters shorter.
In everyday life: Look for Glucagon-like peptide-2 outside the textbook — in sport, cooking, traffic, electronics or the sky above you. An example you found yourself is remembered far longer than one you were given.

Ask Teacher Smith questions about this articleOpens your AI tutor with a question about “Glucagon-like peptide-2” →

Affiliate

Preply — study more efficiently by working with a personal tutor. 50% off.

How to study Glucagon-like peptide-2 in 20 minutes

Read the reference excerpt below once, without taking notes.
Close the page and write down what Glucagon-like peptide-2 means in your own words.
Compare your version with the excerpt and mark what you missed.
Work through the three examples above with pen and paper.
Explain Glucagon-like peptide-2 out loud to somebody else — or to Teacher Smith in the lgStudy chat.

Frequently asked questions

What is Glucagon-like peptide-2 in simple terms?

Why does Glucagon-like peptide-2 matter?

Because it connects several chemistry ideas at once: it gives you a definition you can apply, a quantity you can calculate, and a way to check whether a result is plausible.

How should I study Glucagon-like peptide-2?

Read the excerpt, restate it from memory, then work through the examples and applications listed on this page. The five-step study plan above takes about twenty minutes.

What does this page cover?

It gives you a compact reference excerpt plus original lgStudy explanations, examples, applications and study material on Glucagon-like peptide-2.