biology

ImKTX58

ImKTX58 is a biology topic covered in the lgStudy science library. This page brings together a partial reference excerpt, illustrations, worked examples, real-world applications and a short study plan, so you can understand ImKTX58 rather than just read about it. In short: ImKTX58 (also known as kappa-Buthitoxin-Im1a) is a peptide toxin from the venom of the scorpion species Isometrus maculatus (also known as the lesser brown scorpion). It is known for its selective inhibition of Kv1.3 channels, on which it acts as a pore-blocker.

Key takeaways

ImKTX58 belongs to biology; place it in that map before memorising details.
Learn the definition first, then one example that makes the definition concrete.
Connect ImKTX58 to a quantity you can measure, compute or draw — that is where exam questions come from.
Reproduce the core statement of ImKTX58 from memory before moving on to harder problems.

Reference excerpt

ImKTX58 (also known as kappa-Buthitoxin-Im1a) is a peptide toxin from the venom of the scorpion species Isometrus maculatus (also known as the lesser brown scorpion). It is known for its selective inhibition of Kv1.3 channels, on which it acts as a pore-blocker.

Etymology The name of ImKTX58 stems from its origin in the scorpion species Isometrus maculatus (Im), its action on potassium channels (K), its categorization as a toxin (TX), and its identification as the 58th clone in the Isometrus maculatus cDNA library (58). The protein is also referred to as kappa-Buthitoxin-Im1a, in line with the rational nomenclature system used for toxins produced by venomous species.

Source ImKTX58 is derived from the venom secreted by the glands of Isometrus maculatus (also known as the lesser brown scorpion) which belongs to the Buthidae family. It was first reported from Isometrus maculatus specimens found in Hainan, China.

Chemistry

Structure The entire cDNA of ImKTX58 comprises 404 base pairs and codes for a 60 amino acid precursor, including a signal peptide of 22 amino acids. The mature ImKTX58 protein consists of 38 amino acid residues and has a molecular mass of 4370.14 Da. It features an α-helix at the N-terminus and β-sheet framework at the C-terminus reinforced by cysteine residues and three disulfide bridges, which contribute to its stability. Amino acid sequence of the mature protein: QVHTKIMCSVSRECYEPCHGVTGRAHGKCMNKKCTCYW.

Family and homology ImKTX58 is a small polypeptide toxin from the α-KTX subfamily. It shares sequence homology with other potassium channel blockers from the same subfamily, such as LmKTx10 (74% similarity) and ImKTX88 (54% similarity).

Target and channel specificity ImKTX58 is a potent selective blocker of the Kv1.3 channel, which is a voltage-gated potassium channel essential in regulating neuronal excitability, and in the activation and proliferation of effector memory T cells. Electrophysiological recordings show that ImKTX58 effectively inhibits Kv1.3-mediated currents in Jurkat T cells (IC50 = 39.41 ± 11.4 nM) and HEK293T cells (IC50 = 10.42 ± 1.46 nM). Moreover, ImKTX58 demonstrates a high selectivity for the Kv1.3 channel over other voltage-gated potassium channels, such as Kv1.1, Kv1.2, Kv1.5, as well as calcium-activated potassium channels SK2, SK3, BK, and voltage-gated sodium channels Nav1.4, Nav1.5, Nav1.7.

Mode of action ImKTX58 exerts a partially reversible pore-blocking effect by forming a protein complex with Kv1.3 channels. The amino acid residues at the C-terminus of the toxin, specifically Lys28, Asn31, Arg24, and Tyr37, are significant for the interaction between ImKTX58 and Kv1.3 channels. These residues act through mechanisms such as hydrogen bonding, salt bridges, and hydrophobic interactions. In particular, the Lys28 residue is crucial for effectively blocking the pore of the Kv1.3 channel. This pore blockage leads to increased cellular excitability, ultimately disrupting the regulation of the cell membrane potential. In neurons with higher Kv1.3 expression this results in a higher frequency of action potentials, a slight reduction in their amplitude, and a modest depolarization.

Toxicity The toxicity of ImKTX58 has not been thoroughly characterized. However, Isometrus maculatus has been identified as a species with venom of relatively weak overall toxicity.

References

Worked examples

Example 1 — a first encounter with ImKTX58

Start with the simplest possible case. Write down what ImKTX58 claims or describes in one sentence, then invent the smallest concrete situation in which that sentence is true. In biology, the smallest case is usually a single object, a single equation or a single measurement. Check that every symbol or term in your sentence has a meaning in that case.

Example 2 — changing one variable

Take the situation from Example 1 and change exactly one quantity: double it, halve it, or set it to zero. Predict what should happen to ImKTX58 before you calculate. Comparing your prediction with the result is the fastest way to find out whether you understand the idea or only the words.

Example 3 — an exam-style question

Typical questions about ImKTX58 ask you to (a) state it precisely, (b) apply it to given data, and (c) explain a limitation. Practise writing all three answers in under five minutes; the third part is what separates a full-mark answer from an average one.

Applications of ImKTX58

In research: ImKTX58 appears in biology research whenever the underlying quantities have to be modelled precisely. Papers usually cite it as a starting assumption and then explore where it breaks down.
In technology and industry: Engineering practice reuses ImKTX58 in design rules, simulations and safety margins. Knowing the idea lets you read a specification sheet and understand why the numbers look the way they do.
In the classroom: ImKTX58 is common in secondary-school and first-year university syllabi. It links to neighbouring topics Ion channel toxins, Neurotoxins, Scorpion toxins, so understanding it makes those chapters shorter.
In everyday life: Look for ImKTX58 outside the textbook — in sport, cooking, traffic, electronics or the sky above you. An example you found yourself is remembered far longer than one you were given.

Affiliate

Preply — study more efficiently by working with a personal tutor. 50% off.

How to study ImKTX58 in 20 minutes

Read the reference excerpt below once, without taking notes.
Close the page and write down what ImKTX58 means in your own words.
Compare your version with the excerpt and mark what you missed.
Work through the three examples above with pen and paper.
Explain ImKTX58 out loud to somebody else — or to Teacher Smith in the lgStudy chat.

Frequently asked questions

What is ImKTX58 in simple terms?

Why does ImKTX58 matter?

Because it connects several biology ideas at once: it gives you a definition you can apply, a quantity you can calculate, and a way to check whether a result is plausible.

How should I study ImKTX58?

Read the excerpt, restate it from memory, then work through the examples and applications listed on this page. The five-step study plan above takes about twenty minutes.

What does this page cover?

It gives you a compact reference excerpt plus original lgStudy explanations, examples, applications and study material on ImKTX58.