biology

LmKTx10

LmKTx10 is a biology topic covered in the lgStudy science library. This page brings together a partial reference excerpt, illustrations, worked examples, real-world applications and a short study plan, so you can understand LmKTx10 rather than just read about it. In short: LmKTx10 is a peptide toxin from the venom of the scorpion Lychas mucronatus. The toxin acts as a pore blocker on potassium channels of the family Kv1.

Key takeaways

LmKTx10 belongs to biology; place it in that map before memorising details.
Learn the definition first, then one example that makes the definition concrete.
Connect LmKTx10 to a quantity you can measure, compute or draw — that is where exam questions come from.
Reproduce the core statement of LmKTx10 from memory before moving on to harder problems.

Reference excerpt

LmKTx10 is a peptide toxin from the venom of the scorpion Lychas mucronatus. The toxin acts as a pore blocker on potassium channels of the family Kv1. It has a higher selectivity for the Kv1.3 potassium channel (KCNA3), compared to other channels in the Kv1 family.

Etymology The Name LmKTx10 is derived from the initials of the species Lychas mucronatus, with "K" referring to the action on potassium channels, "Tx" denoting toxin, and 10 relating to the clone number in the cDNA library of the venom glands of Lychas mucronatus.

Source LmKTx10 is derived from the venom of the scorpion Lychas mucronatus. Lychas mucronatus is a species in the genus Lychas (family Buthidae). The scorpion is distributed in the Guangxi Zhuang autonomous region and the Chinese provinces of Hainan and Yunnan.

Chemistry

Structure The precursor nucleotide sequence of LmKTx10 is 180 base pairs long, including a 24 base pair 5'UTR and a 103 base pair 3'UTR. The mature LmKTx10 protein consists of 38 amino acid residues and includes six conserved cysteines (implying three disulfide bridges). This arrangement is characteristic of the cysteine-stabilized alpha/beta motif typical of alpha-KTx scorpion toxins, which stabilizes the N-terminal α-helix and two C-terminal β-sheets of the toxin. The mature peptide sequence is:

QKHTDIKCSSSSSCYEPCRGVTGRAHGKCMNGRCTCYY

Homology and family LmKTx10 belongs to the α-K channel toxin peptides (α-KTx) and displays a 48% sequence identity with α-KTx12.1, α-KTx12.2 and α-KTx12.3 as well as a 74% similarity to ImKTX58.

Target The main targets of LmKTx10 are potassium ion channels. It is part of the α-KTx family, which is known to have its main effect on Kv1 subfamily of potassium channels. LmKTx10 has high to moderate potency for the Kv1.3 KCNA3 potassium channel (IC50 of 28 nM). Comparing this channel potency to other potassium channels clearly shows high selectivity for Kv1.3 as the IC50 for Kv1.1 is 60 times higher (IC50 of 1.73 μM) and for Kv1.2 it is 450 times higher (IC50 of 12.63 μM).

Mode of action LmKTx10 restricts potassium ion flow by occluding the pore of potassium channels. This prevents cells from returning to their electrical resting state after activation, negatively affecting electrical signaling and cell function. Kv1.3 ion channels are highly expressed on effector memory T-cells, blocking these channels inhibits T-cell activation, effector responses, and therefore immune function.

References

Illustrations

Worked examples

Example 1 — a first encounter with LmKTx10

Start with the simplest possible case. Write down what LmKTx10 claims or describes in one sentence, then invent the smallest concrete situation in which that sentence is true. In biology, the smallest case is usually a single object, a single equation or a single measurement. Check that every symbol or term in your sentence has a meaning in that case.

Example 2 — changing one variable

Take the situation from Example 1 and change exactly one quantity: double it, halve it, or set it to zero. Predict what should happen to LmKTx10 before you calculate. Comparing your prediction with the result is the fastest way to find out whether you understand the idea or only the words.

Example 3 — an exam-style question

Typical questions about LmKTx10 ask you to (a) state it precisely, (b) apply it to given data, and (c) explain a limitation. Practise writing all three answers in under five minutes; the third part is what separates a full-mark answer from an average one.

Applications of LmKTx10

In research: LmKTx10 appears in biology research whenever the underlying quantities have to be modelled precisely. Papers usually cite it as a starting assumption and then explore where it breaks down.
In technology and industry: Engineering practice reuses LmKTx10 in design rules, simulations and safety margins. Knowing the idea lets you read a specification sheet and understand why the numbers look the way they do.
In the classroom: LmKTx10 is common in secondary-school and first-year university syllabi. It links to neighbouring topics Ion channel toxins, Neurotoxins, Scorpion toxins, so understanding it makes those chapters shorter.
In everyday life: Look for LmKTx10 outside the textbook — in sport, cooking, traffic, electronics or the sky above you. An example you found yourself is remembered far longer than one you were given.

Affiliate

Preply — study more efficiently by working with a personal tutor. 50% off.

How to study LmKTx10 in 20 minutes

Read the reference excerpt below once, without taking notes.
Close the page and write down what LmKTx10 means in your own words.
Compare your version with the excerpt and mark what you missed.
Work through the three examples above with pen and paper.
Explain LmKTx10 out loud to somebody else — or to Teacher Smith in the lgStudy chat.

Frequently asked questions

What is LmKTx10 in simple terms?

LmKTx10 is a peptide toxin from the venom of the scorpion Lychas mucronatus. The toxin acts as a pore blocker on potassium channels of the family Kv1.

Why does LmKTx10 matter?

Because it connects several biology ideas at once: it gives you a definition you can apply, a quantity you can calculate, and a way to check whether a result is plausible.

How should I study LmKTx10?

Read the excerpt, restate it from memory, then work through the examples and applications listed on this page. The five-step study plan above takes about twenty minutes.

What does this page cover?

It gives you a compact reference excerpt plus original lgStudy explanations, examples, applications and study material on LmKTx10.