biology

Neurotoxin B-IV

Neurotoxin B-IV is a biology topic covered in the lgStudy science library. This page brings together a partial reference excerpt, illustrations, worked examples, real-world applications and a short study plan, so you can understand Neurotoxin B-IV rather than just read about it. In short: Neurotoxin B-IV is a venom peptide secreted by a large marine worm called Cerebratulus lacteus that inhabits the northeastern coast of North America. This neurotoxin belongs to a major type of B polypeptide neurotoxins, which appear to be selectively toxic for crustaceans.

Key takeaways

Neurotoxin B-IV belongs to biology; place it in that map before memorising details.
Learn the definition first, then one example that makes the definition concrete.
Connect Neurotoxin B-IV to a quantity you can measure, compute or draw — that is where exam questions come from.
Reproduce the core statement of Neurotoxin B-IV from memory before moving on to harder problems.

Reference excerpt

Neurotoxin B-IV is a venom peptide secreted by a large marine worm called Cerebratulus lacteus that inhabits the northeastern coast of North America. This neurotoxin belongs to a major type of B polypeptide neurotoxins, which appear to be selectively toxic for crustaceans. The mode of action for neurotoxin B-IV has not been clearly established. However, it is likely that B neurotoxins prolong the repolarization phase of action potentials by interacting with voltage-gated sodium channels.

Etymology and Source Neurotoxin B-IV is found in the mucus secretions of the Atlantic coast marine worm Cerebratulus lacteus. Cerebratulus lacteus produces two major types of polypeptide neurotoxins namely A and B. Toxins B include four neurotoxins designated B-I to B-IV.

Chemistry

Structure Neurotoxin B-IV has a helical structure that looks like a hairpin, and consists of 55 amino acid residues, cross-linked by four disulfide bonds. Its molecular size is about 6000 Dalton. The sequence of the neurotoxin B-IV is ASATWGAAYPACENNCRKKYDLCIRCQGKWAGKRGKCAAHCIIQKNNCKGKCKKE.

Homology The complete structures for two of the four B toxins (B-II and B-IV) have been determined. Toxin B-II differs from B-IV in that the secondary structure of Toxin B-II contains about 15-20% less α-helixes than B-IV due to the differences in the primary structure of the two proteins; amino acids Ala in position 3, Ala in position 7 and Ala in position 8 in B-IV are substituted by amino acids Ser, Gly and Ser in B-II respectively. No homology is displayed with other sodium channel selective toxins, such as scorpion and sea anemone venom toxins, despite being similar in size, basicity, and degree of cross-linking. The secondary structures of scorpion and anemone toxins are largely organized into β-sheet conformations, while the secondary structures of B toxins organize in α-helical conformations.

Family Neurotoxin B-IV belongs to a family of four homologous polypeptide neurotoxins designated B-I to B-IV which are produced by the marine worm Cerebratulus lacteus.

Target Neurotoxin B-IV displays a high affinity binding to a single class of receptor sites on crustacean axon membrane vesicles. B-IV binds to a nerve membrane protein in crustaceans which is similar in size to the β-subunit of sodium channels in nerve and muscle of mammals. The binding site for toxin B-IV is distinct from sodium channel site III, which is targeted by both scorpion and sea anemone toxins.

Mode of Action Neurotoxin B-IV appears to prolong the repolarization phase of the action potential in crustacean nerve sodium channels but does not affect the initial opening of these channels. It is likely that this neurotoxin causes a small depolarization of the resting potential in lobster and crayfish walking leg nerve. Cationic residues are important determinants for polypeptide neurotoxins' function. Specifically, the arginine residues, located within the N-terminal helix, seem to be essential for the activity of neurotoxin B-IV and are most likely directly involved in binding.

Toxicity Neurotoxin B-IV is selectively toxic to crustaceans inducing paralysis, at mean concentrations of about 20 ng/g of body weight. This neurotoxin is the most abundant of the B neurotoxin family and 15-20-fold less toxic than neurotoxin B-II.

References

Worked examples

Example 1 — a first encounter with Neurotoxin B-IV

Start with the simplest possible case. Write down what Neurotoxin B-IV claims or describes in one sentence, then invent the smallest concrete situation in which that sentence is true. In biology, the smallest case is usually a single object, a single equation or a single measurement. Check that every symbol or term in your sentence has a meaning in that case.

Example 2 — changing one variable

Take the situation from Example 1 and change exactly one quantity: double it, halve it, or set it to zero. Predict what should happen to Neurotoxin B-IV before you calculate. Comparing your prediction with the result is the fastest way to find out whether you understand the idea or only the words.

Example 3 — an exam-style question

Typical questions about Neurotoxin B-IV ask you to (a) state it precisely, (b) apply it to given data, and (c) explain a limitation. Practise writing all three answers in under five minutes; the third part is what separates a full-mark answer from an average one.

Applications of Neurotoxin B-IV

In research: Neurotoxin B-IV appears in biology research whenever the underlying quantities have to be modelled precisely. Papers usually cite it as a starting assumption and then explore where it breaks down.
In technology and industry: Engineering practice reuses Neurotoxin B-IV in design rules, simulations and safety margins. Knowing the idea lets you read a specification sheet and understand why the numbers look the way they do.
In the classroom: Neurotoxin B-IV is common in secondary-school and first-year university syllabi. It links to neighbouring topics Invertebrate toxins, Ion channel toxins, Neurotoxins, so understanding it makes those chapters shorter.
In everyday life: Look for Neurotoxin B-IV outside the textbook — in sport, cooking, traffic, electronics or the sky above you. An example you found yourself is remembered far longer than one you were given.

Affiliate

Preply — study more efficiently by working with a personal tutor. 50% off.

How to study Neurotoxin B-IV in 20 minutes

Read the reference excerpt below once, without taking notes.
Close the page and write down what Neurotoxin B-IV means in your own words.
Compare your version with the excerpt and mark what you missed.
Work through the three examples above with pen and paper.
Explain Neurotoxin B-IV out loud to somebody else — or to Teacher Smith in the lgStudy chat.

Frequently asked questions

What is Neurotoxin B-IV in simple terms?

Why does Neurotoxin B-IV matter?

Because it connects several biology ideas at once: it gives you a definition you can apply, a quantity you can calculate, and a way to check whether a result is plausible.

How should I study Neurotoxin B-IV?

Read the excerpt, restate it from memory, then work through the examples and applications listed on this page. The five-step study plan above takes about twenty minutes.

What does this page cover?

It gives you a compact reference excerpt plus original lgStudy explanations, examples, applications and study material on Neurotoxin B-IV.