ArticleslgStudy

biology

Scyllatoxin

Scyllatoxin is a biology topic covered in the lgStudy science library. This page brings together a partial reference excerpt, illustrations, worked examples, real-world applications and a short study plan, so you can understand Scyllatoxin rather than just read about it. In short: Scyllatoxin (also leiurotoxin I) is a toxin, from the scorpion Leiurus quinquestriatus hebraeus, which blocks small-conductance Ca2+-activated K+ channels. It is named after Scylla, a sea monster from Greek mythology.

Scyllatoxin — main illustration
Scyllatoxin — illustration

Key takeaways

  • Scyllatoxin belongs to biology; place it in that map before memorising details.
  • Learn the definition first, then one example that makes the definition concrete.
  • Connect Scyllatoxin to a quantity you can measure, compute or draw — that is where exam questions come from.
  • Reproduce the core statement of Scyllatoxin from memory before moving on to harder problems.

Reference excerpt

Scyllatoxin (also leiurotoxin I) is a toxin, from the scorpion Leiurus quinquestriatus hebraeus, which blocks small-conductance Ca2+-activated K+ channels. It is named after Scylla, a sea monster from Greek mythology. Charybdotoxin is also found in the venom from the same species of scorpion, and is named after the sea monster Charybdis. In Greek mythology, Scylla and Charybdis lived on rocks on opposing sides of a narrow strait of water.

Sources Scyllatoxin is one of the components of the venom of the Israeli scorpion ‘Leiurus quinquestriatus hebraeus’. It consists of only 0.02% of the total protein in crude venom.

Chemistry Leiurotoxin I is a 31-residue peptide (sequence AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2), with a helix and a short antiparallel β-sheet. This toxin is stabilized by disulfide bonds: Cys8-Cys26 and Cys12-Cys28 is bound to the β-sheet, while Cys3-Cys21 is bound to an N-terminal segment preceding the helix. Leiurotoxin adopts the ά/β motif. Especially the positively charged residues (Arg6 and Arg13, which are located in the ά helix) are important for the expression of toxin biological activities and for its receptor affinity.

Target Scyllatoxin is a blocker of small-conductance Ca2+– activated K+ channels at 10−13–10−11 M concentrations in various cell types. This toxin shows similarity in its physiological activity and binding specificity to apamin, but both toxins show no structural similarity.

Mode of action Scyllatoxin blocks the slow after-hyperpolarization that follows an action potential in some nerve cells.

Toxicity Scyllatoxin induces spontaneous contractions in guinea pig taenia coli muscle cells that have been relaxed with epinephrine.

References

Illustrations

Scyllatoxin: Cartoon diagram of scyllatoxin from PDB entry 1scy disulphide bonded residues are shown as sticks
Cartoon diagram of scyllatoxin from PDB entry 1scy disulphide bonded residues are shown as sticks

Worked examples

Example 1 — a first encounter with Scyllatoxin

Start with the simplest possible case. Write down what Scyllatoxin claims or describes in one sentence, then invent the smallest concrete situation in which that sentence is true. In biology, the smallest case is usually a single object, a single equation or a single measurement. Check that every symbol or term in your sentence has a meaning in that case.

Example 2 — changing one variable

Take the situation from Example 1 and change exactly one quantity: double it, halve it, or set it to zero. Predict what should happen to Scyllatoxin before you calculate. Comparing your prediction with the result is the fastest way to find out whether you understand the idea or only the words.

Example 3 — an exam-style question

Typical questions about Scyllatoxin ask you to (a) state it precisely, (b) apply it to given data, and (c) explain a limitation. Practise writing all three answers in under five minutes; the third part is what separates a full-mark answer from an average one.

Applications of Scyllatoxin

In research
Scyllatoxin appears in biology research whenever the underlying quantities have to be modelled precisely. Papers usually cite it as a starting assumption and then explore where it breaks down.
In technology and industry
Engineering practice reuses Scyllatoxin in design rules, simulations and safety margins. Knowing the idea lets you read a specification sheet and understand why the numbers look the way they do.
In the classroom
Scyllatoxin is common in secondary-school and first-year university syllabi. It links to neighbouring topics Ion channel toxins, Neurotoxins, Scorpion toxins, so understanding it makes those chapters shorter.
In everyday life
Look for Scyllatoxin outside the textbook — in sport, cooking, traffic, electronics or the sky above you. An example you found yourself is remembered far longer than one you were given.
Ask Teacher Smith questions about this articleOpens your AI tutor with a question about “Scyllatoxin” →

Affiliate

Preply — study more efficiently by working with a personal tutor. 50% off.

How to study Scyllatoxin in 20 minutes

  1. Read the reference excerpt below once, without taking notes.
  2. Close the page and write down what Scyllatoxin means in your own words.
  3. Compare your version with the excerpt and mark what you missed.
  4. Work through the three examples above with pen and paper.
  5. Explain Scyllatoxin out loud to somebody else — or to Teacher Smith in the lgStudy chat.

Frequently asked questions

What is Scyllatoxin in simple terms?

Scyllatoxin (also leiurotoxin I) is a toxin, from the scorpion Leiurus quinquestriatus hebraeus, which blocks small-conductance Ca2+-activated K+ channels. It is named after Scylla, a sea monster from Greek mythology.

Why does Scyllatoxin matter?

Because it connects several biology ideas at once: it gives you a definition you can apply, a quantity you can calculate, and a way to check whether a result is plausible.

How should I study Scyllatoxin?

Read the excerpt, restate it from memory, then work through the examples and applications listed on this page. The five-step study plan above takes about twenty minutes.

What does this page cover?

It gives you a compact reference excerpt plus original lgStudy explanations, examples, applications and study material on Scyllatoxin.

Tags

  • Ion channel toxins
  • Neurotoxins
  • Scorpion toxins

Keep exploring