biology

Tamapin

Tamapin is a biology topic covered in the lgStudy science library. This page brings together a partial reference excerpt, illustrations, worked examples, real-world applications and a short study plan, so you can understand Tamapin rather than just read about it. In short: Tamapin is a toxin from the Indian Red Scorpion (Hottentotta tamulus), which is a selective and potent blocker of SK2 channels. Etymology Tamapin is named after the scorpion from which it was isolated.

Key takeaways

Tamapin belongs to biology; place it in that map before memorising details.
Learn the definition first, then one example that makes the definition concrete.
Connect Tamapin to a quantity you can measure, compute or draw — that is where exam questions come from.
Reproduce the core statement of Tamapin from memory before moving on to harder problems.

Reference excerpt

Tamapin is a toxin from the Indian Red Scorpion (Hottentotta tamulus), which is a selective and potent blocker of SK2 channels.

Etymology Tamapin is named after the scorpion from which it was isolated.

Sources Tamapin has been isolated from hottentotta tamulus, the Indian red scorpion.

Chemical structure and methods of isolation Tamapin belongs to short-chain scorpion toxin subfamily 5, together with PO5 and Scyllatoxin. Its sequence similarity to other toxins that can compete with the binding site of apamin is much lower. It is 31 amino acids long and its weight is 3458 daltons. Its amino acid sequence is AFCNLRRCELSCRSLGLLGKCIGEECKCVPY, with disulfide bonds between Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28 (chemical formula C146H234N42O42S6). Tamapin has been isolated via detection of the apamin-competing fraction of the venom from the scorpion via a Sephadex G-50 size exclusion chromatography, followed by high performance liquid chromatography (HPLC). An isoform of tamapin, tamapin-2, has been found, in which the tyrosine is replaced by a histadine. Tamapin-2 can also compete very effectively with apamin for binding to synaptosomes.

Target and mode of action The target of tamapin is the small conductance calcium-dependent potassium (SK) channel. This scorpion toxin blocks SK2 channels with selectivity for SK2 versus SK1 channels in a largely reversible manner. Despite completely different sequences, Apamin (a bee venom toxin) and tamapin share at least in part, the same binding sites on rat brain synaptosomes. Cloned SK2 are most sensitive for Apamin in binding assays and physiological recordings. However, tamapin displaces Apamin in binding assays and is therefore a stronger toxin with respect to Apamin. SK 1 and SK 3 are only affected with a high concentration of tapamin and therefore this toxin inhibits SK2 with the highest affinity, SK3 intermediate and the lowest affinity for SK1 channels. A less closely related member of the SK channels is the intermediate conductance calcium activated potassium channel SK4, also known as IK1, which is not sensitive to Apamin and is also not affected by Tapamin. The same applies to voltage dependent potassium channels; the block of SK2-mediated currents is not voltage dependent. This specific channel block evokes a reduction in the small conductance calcium-dependent potassium channels current.

Toxicity Previous studies showed that the effect of tamapin is largely reversible and depends on time and concentration. The Indian red scorpion (Hottentotta tamulus) causes a large number of deaths annually especially among young children. Its venom contains highly specific potassium channel blockers such as iberiotoxin, which is a highly specific blocker of the high conductance calcium activated potassium channel, and tamulustoxin.

References

Worked examples

Example 1 — a first encounter with Tamapin

Start with the simplest possible case. Write down what Tamapin claims or describes in one sentence, then invent the smallest concrete situation in which that sentence is true. In biology, the smallest case is usually a single object, a single equation or a single measurement. Check that every symbol or term in your sentence has a meaning in that case.

Example 2 — changing one variable

Take the situation from Example 1 and change exactly one quantity: double it, halve it, or set it to zero. Predict what should happen to Tamapin before you calculate. Comparing your prediction with the result is the fastest way to find out whether you understand the idea or only the words.

Example 3 — an exam-style question

Typical questions about Tamapin ask you to (a) state it precisely, (b) apply it to given data, and (c) explain a limitation. Practise writing all three answers in under five minutes; the third part is what separates a full-mark answer from an average one.

Applications of Tamapin

In research: Tamapin appears in biology research whenever the underlying quantities have to be modelled precisely. Papers usually cite it as a starting assumption and then explore where it breaks down.
In technology and industry: Engineering practice reuses Tamapin in design rules, simulations and safety margins. Knowing the idea lets you read a specification sheet and understand why the numbers look the way they do.
In the classroom: Tamapin is common in secondary-school and first-year university syllabi. It links to neighbouring topics Ion channel toxins, Neurotoxins, so understanding it makes those chapters shorter.
In everyday life: Look for Tamapin outside the textbook — in sport, cooking, traffic, electronics or the sky above you. An example you found yourself is remembered far longer than one you were given.

Ask Teacher Smith questions about this articleOpens your AI tutor with a question about “Tamapin” →

Affiliate

Preply — study more efficiently by working with a personal tutor. 50% off.

How to study Tamapin in 20 minutes

Read the reference excerpt below once, without taking notes.
Close the page and write down what Tamapin means in your own words.
Compare your version with the excerpt and mark what you missed.
Work through the three examples above with pen and paper.
Explain Tamapin out loud to somebody else — or to Teacher Smith in the lgStudy chat.

Frequently asked questions

What is Tamapin in simple terms?

Tamapin is a toxin from the Indian Red Scorpion (Hottentotta tamulus), which is a selective and potent blocker of SK2 channels. Etymology Tamapin is named after the scorpion from which it was isolated.

Why does Tamapin matter?

Because it connects several biology ideas at once: it gives you a definition you can apply, a quantity you can calculate, and a way to check whether a result is plausible.

How should I study Tamapin?

Read the excerpt, restate it from memory, then work through the examples and applications listed on this page. The five-step study plan above takes about twenty minutes.

What does this page cover?

It gives you a compact reference excerpt plus original lgStudy explanations, examples, applications and study material on Tamapin.